PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSMUA_Achr3P15190_001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Zingiberales; Musaceae; Musa
Family HD-ZIP
Protein Properties Length: 237aa    MW: 26200.6 Da    PI: 9.0952
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSMUA_Achr3P15190_001genomeCIRADView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.31.3e-1889143256
                            T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
               Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                            rk+ ++tkeq   Le+ F+++++++ +++  LAk+l+L  rqV vWFqNrRa+ k
  GSMUA_Achr3P15190_001  89 RKKLRLTKEQSALLEDRFKEHSTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTK 143
                            78889************************************************98 PP

2HD-ZIP_I/II125.52.3e-4089178191
            HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLr 88 
                            +kk+rl+keq++lLE+ F+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l++en+rL+ke +eL+
  GSMUA_Achr3P15190_001  89 RKKLRLTKEQSALLEDRFKEHSTLNPKQKHALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEFLKRCCESLTDENRRLHKELQELK 176
                            69*************************************************************************************9 PP

            HD-ZIP_I/II  89 eel 91 
                             +l
  GSMUA_Achr3P15190_001 177 -AL 178
                            .55 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.7E-1871143IPR009057Homeodomain-like
SuperFamilySSF466893.76E-1977146IPR009057Homeodomain-like
PROSITE profilePS5007117.285145IPR001356Homeobox domain
SMARTSM003899.8E-1687149IPR001356Homeobox domain
CDDcd000862.62E-1688146No hitNo description
PfamPF000465.6E-1689143IPR001356Homeobox domain
PROSITE patternPS000270120143IPR017970Homeobox, conserved site
PfamPF021834.4E-11145179IPR003106Leucine zipper, homeobox-associated
SMARTSM003404.4E-24145188IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 237 aa     Download sequence    Send to blast
MAQKQPSLML SLPHDVYNGE ANKGSEEGRQ ARPSSPHSTV SSFSTAYTPT TMKKEKDDGG  60
SGGGGEEADT ARADSRGGSY DDNDDGSPRK KLRLTKEQSA LLEDRFKEHS TLNPKQKHAL  120
AKQLNLRPRQ VEVWFQNRRA RTKLKQTEVD CEFLKRCCES LTDENRRLHK ELQELKALKL  180
APPPVCMQFP AATLTMCPSC KTIRAAADGP KGGGAEPFVV APAKHHFFHP FIHSASC
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009392387.11e-177PREDICTED: homeobox-leucine zipper protein HOX19
SwissprotA2XE765e-79HOX19_ORYSI; Homeobox-leucine zipper protein HOX19
SwissprotQ8GRL45e-79HOX19_ORYSJ; Homeobox-leucine zipper protein HOX19
TrEMBLM0SET51e-178M0SET5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr3P15190_0011e-178(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP20553698
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37790.13e-62HD-ZIP family protein